Top 25 Paleo Pumpkin Recipes

paleopumpkinrecipes

The weather is getting crisp and cool and the leaves are starting to change into glorious colors. This means one thing:

It’s PUMPKIN season!!!

 

I love….okay, totally obsessed is more like it…..with all things pumpkin so I rounded up my top 25 favorite Paleo pumpkin recipes and put them into one place for everyone to enjoy.

 

I’ve included sweet, mouthwatering treats, savory pumpkin-y goodness, and delicious pumpkin beverages. If you are a fellow pumpkin lover, you are sure to love these healthy, real food pumpkin recipes, too. Enjoy!

 

sweets Click on the underlined recipe title to take you to each recipe

 

Chocolate Swirl Pumpkin Cheesecake Bars from Mindful Mama

pumpkincheesecakemindfulmama

 

Pumpkin Fudge from The Coconut Mama

pumpkinfudgecoconutmama  

Pumpkin Roll from Primally Inspired

pumpkinroll

 

Pumpkin Pie Ice Cream from Healthy Living How To

pumpkinpieicecreamhealthylivinghowto

 

Pumpkin Pie Bars from Clean Eats in the Zoo

pumpkinpiebarscleaneatsinthezoo  

 Pumpkin “Cheesecake” Cups from Primally Inspired

pumpkincups

 Pumpkin Mousse from Empowered Sustenance

pumpkinmousseempoweredsustenance

 

Pumpkin Pie Coconut Flour Pancakes from Real Food Outlaws

PumpkinPieCoconutFlourPancakesrealfoodoutlaws  

Pumpkin Souffle from Primally Inspired

pumpkinsouffle5

 

Pumpkin Spice Poppers from Rubies and Radishes

pumpkinpoppersrubiesandradishes

 

Pumpkin Bread Pudding from A Girl Worth Saving

breadpuddinggirlworthsaving

 

Pumpkin Cupcakes with Cream Cheese Frosting from Ancestral Nutrition (includes dairy in the frosting)

pumpkincupcakesancestralnutrition

 

Pumpkin Spice Muffins from Homemade Mommy

Pumpkin-Spice-Muffins-Grain-free-1024x647

 

Pumpkin Bread with Caramel Glaze from Primally Inspired 

pumpkinbreadcaramelglaze

 

Pumpkin Caramel Bars from Paleo in PDX

pumpkincaramelbarspaleoinpdx

 

Cinnamon Maple Pumpkin Seed Butter from The Dabbilist

pumpkinseedbutterdabbilist

 

  

savory

Pumpkin Beef Chili from Living Low Carb One Day At A Time

pumpkin-chili_livinglowcarbonedayatatime  

Pork and Pumpkin Chili from Primally Inspired

pumpkinchili

 

Sweet Potato Gratin from Meatified

sweetpotatogratinmeatified  

Curried Pumpkin Seeds from Real Food RN

curry-spiced-pumpkin-seedsrealfoodrn  

Pumpkin Soup from Grass Fed Girl

Pumpkin-soup

 

 

beverages

Pumpkin Spice Creamer from The Coconut Mama

pumpkincreamercoconutmama

 

Pumpkin Spice Latte from The Rising Spoon

vegan-pumpkin-spice-latte-risingspoon  

Pumpkin Pie Protein Shake from Freshly Grown (I sub THIS gelatin for the protein powder)

Pumpkin-Pie-Protein-Shake-freshlygrown

 

Pumpkin Pie Smoothie from The Paleo Mama

pumpkin-pie-smoothiepaleomama

 

 And I’ll end with a BONUS recipe!

How To Make Your Own Pumpkin Pie Spice from The Rising Spoon

homemade pumpkin pie spice 1, the rising spoon

 

Enjoy your Fall, everyone! I wish you lots of great smells coming out of your kitchen this beautiful Autumn season :)

 

What are some of your favorite Fall recipes? Are there any in this list that you can’t wait to try?

  lovekelly

FTC DISCLOSURE: In order for me to support my blogging activities, I may receive monetary compensation or other types of remuneration for my endorsement, recommendation, testimonial and/or link to any products or services from this blog.


20 Responses to Top 25 Paleo Pumpkin Recipes

  1. Regina says:

    What a treat!! Thank you for sharing!
    Regina

  2. Oh, man! These all look amazing! Thanks for sharing my pumpkin pie bars!!

  3. What a treat for my eyes! I love your Pumpkin Roll – I might try it soon. The Pumpkin Mousse looks great too.

  4. Rama says:

    Thanks for sharing the pumpkin pie protein shake, Kelly! I didn’t even think to use gelatin, hello? ;) Great idea. -Rama, VGN

  5. Diana says:

    YUMMY! I am a certified pumpkin obsessed nut, I might do “25 days of pumpkin” and try all these recipes! Haha! This is great! Thank you so much for posting!

  6. Olivia says:

    Thanks for dinner tonight. I have meatified’s sweet potato gratin in the oven!! I am also debating on whipping up some more of your pumpkin almond butter to put on apples for dessert. Thanks as always for keeping me fed :)

  7. Pingback: Autumn Chocolate Bites | Primally Inspired

  8. Michele K says:

    Gotta try these! I created a breakfast pumpkin custard pie that is a hit in my home! We eat this hearty healthy breakfast yr round! The starter mix is freezable. I make 3-6 jar batches at a time and take out the jar the night b4. In the morning, I add coconut oil and eggs and bake or stove top it on low heat in 15 min. Yum. I’ve made a banana nut variation.

  9. Pingback: 8 Tips To Enjoy A Gluten-Free Halloween » Amy Myers, MD Functional Medicine

  10. Pingback: 8 Tips To Enjoy A Gluten-Free Halloween | Health DoneHealth Done

  11. Pingback: 8 Tips To Enjoy A Gluten-Free Halloween - Primal Docs

  12. Pingback: Austin Ultra Health

  13. Pingback: paleo pumpkin recipes | Paleo Recipe Book

  14. Terry says:

    Desperately searching for a pumpkin salsa recipe! Do you have one to share?

Leave a Reply

Your email address will not be published. Required fields are marked *

You may use these HTML tags and attributes: <a href="" title=""> <abbr title=""> <acronym title=""> <b> <blockquote cite=""> <cite> <code> <del datetime=""> <em> <i> <q cite=""> <strike> <strong>

Get FREE weekly recipes, nutrition tips, fitness and natural living posts from Primally Inspired!
Click here to sign up!